Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDFY2 Peptide - C-terminal region

WDFY2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDFY2, WDF2, ZFYVE22

UniProt

Q96P53

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDFY2 Rabbit Polyclonal Antibody (orb586582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_443182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RQLISCGGDGGIVVWNMDVERQETPEWLDSDSCQKCDQPFFWNFKQMWDS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dry Bath Incubator BDIB-104
BDIB-104 1 Unit

Dry Bath Incubator BDIB-104

Sign In for Pricing
View Details
ACAT1 (NM_000019) Human Over-expression Lysate
LY424978 100 µg

ACAT1 (NM_000019) Human Over-expression Lysate

Sign In for Pricing
View Details
Myosin (MYL4) (NM_001002841) Human Over-expression Lysate
LC425089 20 µg

Myosin (MYL4) (NM_001002841) Human Over-expression Lysate

Sign In for Pricing
View Details
Chk1 (CHEK1) Rabbit Polyclonal Antibody
TA372232 100 µL

Chk1 (CHEK1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Adenosine A3 Receptor (ADORA3) (NM_000677) Human Over-expression Lysate
LC400224 20 µg

Adenosine A3 Receptor (ADORA3) (NM_000677) Human Over-expression Lysate

Sign In for Pricing
View Details
Fumagillol
TRC-F862660-1MG 1 mg

Fumagillol

Sign In for Pricing
View Details