SGTB Peptide - N-terminal region
SGTB Peptide - N-terminal region
Product Specifications
Product Name Alternative
SGTB, SGT2
UniProt
Q96EQ0
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SGTB Rabbit Polyclonal Antibody (orb586645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005248605
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CL-H0217-01 24 Tests
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
Sign In for Pricing
View Details E-CL-H0217-02 48 Tests
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
Sign In for Pricing
View Details E-CL-H0217-03 96 Tests
Human ACTα1 (Actin Alpha 1, Skeletal Muscle) CLIA Kit
Sign In for Pricing
View Details 
LY433113 100 µg
BRUNOL6 (CELF6) (NM_001172684) Human Over-expression Lysate
Sign In for Pricing
View Details 
PKSH033681-01 10 µg
Recombinant Human FABP6/I-BABP Protein (His Tag)
Sign In for Pricing
View Details