Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SGTB Peptide - N-terminal region

SGTB Peptide - N-terminal region

Product Specifications

Product Name Alternative

SGTB, SGT2

UniProt

Q96EQ0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SGTB Rabbit Polyclonal Antibody (orb586645) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005248605

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FCKNDVLPLSNSVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIELD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI10C5]
CF812519 100 µg

ZNF317 Mouse Monoclonal Antibody [Clone ID: OTI10C5]

Sign In for Pricing
View Details
N-(n-Butanesulfonyl)-O-[4-(4-pyridinyl)-butyl]-(S)-tyrosine
TRC-B690160-50MG 50 mg

N-(n-Butanesulfonyl)-O-[4-(4-pyridinyl)-butyl]-(S)-tyrosine

Sign In for Pricing
View Details
MMP13 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]
TA506803BM 100 µL

MMP13 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A6]

Sign In for Pricing
View Details
SERPINB2 (NM_002575) Human Over-expression Lysate
LY400915 100 µg

SERPINB2 (NM_002575) Human Over-expression Lysate

Sign In for Pricing
View Details
Biotin Conjugated Human CD48 Recombinant Rabbit Monoclonal Antibody [PSH08-38] - Detector
HA722981B 100 µL

Biotin Conjugated Human CD48 Recombinant Rabbit Monoclonal Antibody [PSH08-38] - Detector

Sign In for Pricing
View Details
Aflatoxin G1
TRC-A357480-5MG 5 mg

Aflatoxin G1

Sign In for Pricing
View Details