Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO1 Peptide - C-terminal region

ANO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANO1, DOG1, ORAOV2, TAOS2, TMEM16A

UniProt

Q5XXA6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO1 Rabbit Polyclonal Antibody (orb587875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060513

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TULP2 shRNA (UAS) - Lentiviral human TULP2 shRNA (UAS) plasmid
GTR15093811 1 Vial

Lentiviral human TULP2 shRNA (UAS) - Lentiviral human TULP2 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Rabbit Polyclonal CLUAP1 Antibody [DyLight 755]
NBP3-06085IR 0.1 mL

Rabbit Polyclonal CLUAP1 Antibody [DyLight 755]

Sign In for Pricing
View Details
Rat TRPV4 (Transient Receptor Potential Cation Channel Subfamily V, Member 4) ELISA Kit
EK240332 96 Well

Rat TRPV4 (Transient Receptor Potential Cation Channel Subfamily V, Member 4) ELISA Kit

Sign In for Pricing
View Details
TMEM88B AAV Vector (Human) (CMV)
47104101 1 µg

TMEM88B AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human NEUROG2 Recombinant Protein (N-His-SUMO)
HD996012-01 50 µg

Human NEUROG2 Recombinant Protein (N-His-SUMO)

Sign In for Pricing
View Details
Human NEUROG2 Recombinant Protein (N-His-SUMO)
HD996012-02 100 µg

Human NEUROG2 Recombinant Protein (N-His-SUMO)

Sign In for Pricing
View Details