Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANO1 Peptide - C-terminal region

ANO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ANO1, DOG1, ORAOV2, TAOS2, TMEM16A

UniProt

Q5XXA6

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANO1 Rabbit Polyclonal Antibody (orb587875) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060513

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LMVELFMREEQDKQQLLETWMEKERQKDEPPCNHHNTKACPDSLGSPAPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human LIMD1 sgRNA gene knockout kit - Lentiviral human LIMD1 sgRNA gene knockout kit (25)
GTR15399891 1 Vial

Lentiviral human LIMD1 sgRNA gene knockout kit - Lentiviral human LIMD1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Desmethoxy Iopromide (Related Compound B)
008500 1 mg

Desmethoxy Iopromide (Related Compound B)

Sign In for Pricing
View Details
FUS Antibody
orb3053274-01 50 µL

FUS Antibody

Sign In for Pricing
View Details
FUS Antibody
orb3053274-02 100 µL

FUS Antibody

Sign In for Pricing
View Details
ASB8 Protein Lysate (Rat) with C-HA Tag
12518036 100 µg

ASB8 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human IgG (Fc specific) Rabbit Polyclonal Antibody
R1337TR 2 mg

Human IgG (Fc specific) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details