Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT79 Peptide - C-terminal region

KRT79 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT79, K6L, KB38, KRT6L

UniProt

Q5XKE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT79 Rabbit Polyclonal Antibody (orb588026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787028

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELTRTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Gpr65 Pre-designed siRNA Set B
SI105793B 1 Each

Mouse Gpr65 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Tcp11l2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7450308 1.0 µg DNA

Tcp11l2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human ZNF347 qPCR Primer Pair
QH56281S 200 Tests

Human ZNF347 qPCR Primer Pair

Sign In for Pricing
View Details
Calcium alpha-ketovaline
90027012 1 g

Calcium alpha-ketovaline

Sign In for Pricing
View Details
Lentiviral mouse Fbxl22 shRNA (UAS) - Lentiviral mouse Fbxl22 shRNA (UAS, GFP) (100)
GTR15271977 1 Vial

Lentiviral mouse Fbxl22 shRNA (UAS) - Lentiviral mouse Fbxl22 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Bovine β 3 adrenergic receptor (ADRB3) ELISA Kit
GTR10326445 96 Well

Bovine β 3 adrenergic receptor (ADRB3) ELISA Kit

Sign In for Pricing
View Details