Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRT79 Peptide - C-terminal region

KRT79 Peptide - C-terminal region

Product Specifications

Product Name Alternative

KRT79, K6L, KB38, KRT6L

UniProt

Q5XKE5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRT79 Rabbit Polyclonal Antibody (orb588026) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_787028

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQYELIAQRSRAEAEAWYQTKYEELQVTAGKHGDNLRDTKNEIAELTRTI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD1A (O10) HRP
sc-18885 HRP 200 µg/mL

CD1A (O10) HRP

Sign In for Pricing
View Details
Human TMEM49 (VMP1) activation kit by CRISPRa
GA113107 1 Kit

Human TMEM49 (VMP1) activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Human CD11a/ITGAL Protein, N-His
orb2968965-01 50 µg

Recombinant Human CD11a/ITGAL Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD11a/ITGAL Protein, N-His
orb2968965-02 100 µg

Recombinant Human CD11a/ITGAL Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD11a/ITGAL Protein, N-His
orb2968965-03 1 mg

Recombinant Human CD11a/ITGAL Protein, N-His

Sign In for Pricing
View Details
RPS8 Antibody
orb671570-01 50 µg

RPS8 Antibody

Sign In for Pricing
View Details