Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPDU1 Peptide - C-terminal region

MPDU1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPDU1

UniProt

O75352

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPDU1 Rabbit Polyclonal Antibody (orb588056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apold1 Mouse Gene Knockout Kit (CRISPR)
KN501436 1 Kit

Apold1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (KRT8/2174R), CF568 conjugate, 0.1mg/mL
BNC682174-500 1x 500 µL

Cytokeratin 8 (KRT8) (KRT8/2174R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD62L (L-Selectin) (LAM1-116), 0.2mg/mL
BNUB1587-500 1x 500 µL

CD62L (L-Selectin) (LAM1-116), 0.2mg/mL

Sign In for Pricing
View Details
LILRB2 (NM_001080978) Human Over-expression Lysate
LY421144 100 µg

LILRB2 (NM_001080978) Human Over-expression Lysate

Sign In for Pricing
View Details
MUC16 Mouse Monoclonal Antibody [Clone ID: 23]
AM09242PU-N 500 µg

MUC16 Mouse Monoclonal Antibody [Clone ID: 23]

Sign In for Pricing
View Details
Tissue FFPE Sections, Stomach
CS707975 5x 5 µm

Tissue FFPE Sections, Stomach

Sign In for Pricing
View Details