Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPDU1 Peptide - C-terminal region

MPDU1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MPDU1

UniProt

O75352

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MPDU1 Rabbit Polyclonal Antibody (orb588056) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LARIFTSIQETGDPLMAGTFVVSSLCNGLIAAQLLFYWNAKPPHKQKKAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL 28A Mouse
OM296602-01 20 µg

IL 28A Mouse

Sign In for Pricing
View Details
IL 28A Mouse
OM296602-02 5 µg

IL 28A Mouse

Sign In for Pricing
View Details
IL 28A Mouse
OM296602-03 1 mg

IL 28A Mouse

Sign In for Pricing
View Details
MTRES1 (NM_001142468) Human Over-expression Lysate
LC428114 20 µg

MTRES1 (NM_001142468) Human Over-expression Lysate

Sign In for Pricing
View Details
Human SP-D Antibody Pair Set
E-KAB-0258 50 µL & 100 µg

Human SP-D Antibody Pair Set

Sign In for Pricing
View Details
Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF640R conjugate, 0.1mg/mL
BNC403732-100 1x 100 µL

Tubulin beta 3 / TUBB3 (Neuronal & Stem Cell Marker) (TUBB3/3732), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details