Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V0A4 Peptide - middle region

ATP6V0A4 Peptide - middle region

Product Specifications

Product Name Alternative

ATP6V0A4, ATP6N1B, ATP6N2

UniProt

Q9HBG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP6V0A4 Rabbit Polyclonal Antibody (orb588072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF2 Rabbit pAb
E47R34106 100 µL

NF2 Rabbit pAb

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
MBS1195943-01 0.02 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
MBS1195943-02 0.1 mg (E-Coli)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
MBS1195943-03 0.02 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
MBS1195943-04 0.1 mg (Yeast)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)

Sign In for Pricing
View Details
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
MBS1195943-05 0.02 mg (Baculovirus)

Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)

Sign In for Pricing
View Details