ATP6V0A4 Peptide - middle region
ATP6V0A4 Peptide - middle region
Product Specifications
Product Name Alternative
ATP6V0A4, ATP6N1B, ATP6N2
UniProt
Q9HBG4
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6V0A4 Rabbit Polyclonal Antibody (orb588072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1195943-01 0.02 mg (E-Coli)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
Sign In for Pricing
View Details MBS1195943-02 0.1 mg (E-Coli)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
Sign In for Pricing
View Details MBS1195943-03 0.02 mg (Yeast)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
Sign In for Pricing
View Details MBS1195943-04 0.1 mg (Yeast)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
Sign In for Pricing
View Details MBS1195943-05 0.02 mg (Baculovirus)
Recombinant Schizosaccharomyces pombe Uncharacterized protein C186.04c (SPAC186.04c)
Sign In for Pricing
View Details