Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP6V0A4 Peptide - middle region

ATP6V0A4 Peptide - middle region

Product Specifications

Product Name Alternative

ATP6V0A4, ATP6N1B, ATP6N2

UniProt

Q9HBG4

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ATP6V0A4 Rabbit Polyclonal Antibody (orb588072) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ADATRIKRALEQGMELSGSSMAPIMTTVQSKTAPPTFNRTNKFTAGFQNI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS6KB1 Antibody
A48643-50UL 50 μL

RPS6KB1 Antibody

Sign In for Pricing
View Details
Anti-PI4KB Antibody Picoband®, Carrier-free
A04249-2-carrier-free 100 µg/Vial

Anti-PI4KB Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Lentiviral mouse Zfp809 shRNA (UAS) - Lentiviral mouse Zfp809 shRNA (UAS, iRFP) plasmid
GTR15263308 1 Vial

Lentiviral mouse Zfp809 shRNA (UAS) - Lentiviral mouse Zfp809 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
S53P4 Bioactive Glass Powder
CER-0042 100 g

S53P4 Bioactive Glass Powder

Sign In for Pricing
View Details
Mouse Protein maelstrom homolog (MAEL) ELISA Kit
orb1653532-01 48 Tests

Mouse Protein maelstrom homolog (MAEL) ELISA Kit

Sign In for Pricing
View Details
Mouse Protein maelstrom homolog (MAEL) ELISA Kit
orb1653532-02 96 Tests

Mouse Protein maelstrom homolog (MAEL) ELISA Kit

Sign In for Pricing
View Details