BLK Peptide - N-terminal region
BLK Peptide - N-terminal region
Product Specifications
Product Name Alternative
BLK
UniProt
P51451
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BLK Rabbit Polyclonal Antibody (orb331428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001706
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
302464-HRP 200 µL
GBP2 (Interferon-Induced Guanylate-Binding Protein 2, GTP-Binding Protein 2, GBP-2, HuGBP-2, Guanine Nucleotide-Binding Protein 2, GBP2) (HRP) discontinued
Sign In for Pricing
View Details 
PA1662-FITC 100 µg/Vial
Anti-Netrin 1/NTN1 Antibody Picoband®, FITC Conjugate
Sign In for Pricing
View Details