Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BLK Peptide - N-terminal region

BLK Peptide - N-terminal region

Product Specifications

Product Name Alternative

BLK

UniProt

P51451

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BLK Rabbit Polyclonal Antibody (orb331428) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001706

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGLVSSKKPDKEKPIKEKDKGQWSPLKVSAQDKDAPPLPPLVVFNHLTPP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Keratin 1 (KRT1) ELISA Kit
MBS2701876-01 24 Strip Well

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin 1 (KRT1) ELISA Kit
MBS2701876-02 48 Well

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin 1 (KRT1) ELISA Kit
MBS2701876-03 96 Well

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin 1 (KRT1) ELISA Kit
MBS2701876-04 5x 96 Well

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details
Rat Keratin 1 (KRT1) ELISA Kit
MBS2701876-05 10x 96 Well

Rat Keratin 1 (KRT1) ELISA Kit

Sign In for Pricing
View Details
FAU, NT (Ubiquitin-like Protein FUBI) (PE) discontinued
F0020-20-PE 200 µL

FAU, NT (Ubiquitin-like Protein FUBI) (PE) discontinued

Sign In for Pricing
View Details