Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO2 Peptide - C-terminal region

CALCOCO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALCOCO2, NDP52

UniProt

Q13137

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALCOCO2 Rabbit Polyclonal Antibody (orb331429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOE 33187
orb1308225-01 25 mg

HOE 33187

Sign In for Pricing
View Details
HOE 33187
orb1308225-02 50 mg

HOE 33187

Sign In for Pricing
View Details
HOE 33187
orb1308225-03 10 mg

HOE 33187

Sign In for Pricing
View Details
TREML1 Antibody
orb357283-01 50 µg

TREML1 Antibody

Sign In for Pricing
View Details
TREML1 Antibody
orb357283-02 100 µg

TREML1 Antibody

Sign In for Pricing
View Details
Polyclonal Antibody to Activating Transcription Factor 1 (ATF1)
TRV-0041033-01 20 µL

Polyclonal Antibody to Activating Transcription Factor 1 (ATF1)

Sign In for Pricing
View Details