Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CALCOCO2 Peptide - C-terminal region

CALCOCO2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CALCOCO2, NDP52

UniProt

Q13137

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CALCOCO2 Rabbit Polyclonal Antibody (orb331429) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRLLSYMGLDFNSLPYQVPTSDEGGARQNPGLAYGNPYSGIQESSSPSPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pnisr Protein Vector (Human) (pPB-N-His)
PV112043 500 ng

Pnisr Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
p60 v-src (137-157)
H-8535.1000 1.0mg

p60 v-src (137-157)

Sign In for Pricing
View Details
LCT (Lactase, LAC, LPH, LPH1)
248095 100 µg

LCT (Lactase, LAC, LPH, LPH1)

Sign In for Pricing
View Details
Human Factor Beta IXa Inactivated Purified
MBS8411796-01 0.5 mg

Human Factor Beta IXa Inactivated Purified

Sign In for Pricing
View Details
Human Factor Beta IXa Inactivated Purified
MBS8411796-02 5x 0.5 mg

Human Factor Beta IXa Inactivated Purified

Sign In for Pricing
View Details
LA-PEG-SCM, 2K
HE039024-2K Inquire

LA-PEG-SCM, 2K

Sign In for Pricing
View Details