Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD6 Peptide - C-terminal region

CD6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CD6

UniProt

P30203

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD6 Rabbit Polyclonal Antibody (orb588079) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006716

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DSSSTSSGEWYQNFQPPPQPPSEEQFGCPGSPSPQPDSTDNDDYDDISAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPATS1 Antibody, FITC conjugated
A56600-50UG 50 µg

SPATS1 Antibody, FITC conjugated

Sign In for Pricing
View Details
SACM1L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2085305 3x 1.0 µg

SACM1L sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
SCARNA9 sgRNA CRISPR Lentivector (Human) (Target 3)
K2096704 1.0 µg DNA

SCARNA9 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Recombinant Human NOG Protein, N-His
E55P2330 50 µg

Recombinant Human NOG Protein, N-His

Sign In for Pricing
View Details
Rabbit Polyclonal DIRAS3 Antibody [Janelia Fluor 646]
NBP2-82085JF646 0.1 mL

Rabbit Polyclonal DIRAS3 Antibody [Janelia Fluor 646]

Sign In for Pricing
View Details
Rat Monoclonal Thrombomodulin/BDCA-3 Antibody (4D8.2C6) [HRP]
NBP2-36496H 0.1 mL

Rat Monoclonal Thrombomodulin/BDCA-3 Antibody (4D8.2C6) [HRP]

Sign In for Pricing
View Details