Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD63 Peptide - middle region

CD63 Peptide - middle region

Product Specifications

Product Name Alternative

CD63, MLA1, TSPAN30

UniProt

P08962

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD63 Rabbit Polyclonal Antibody (orb588080) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001771

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK40 siRNA (Rat)
CRR5682-01 15 nmol

STK40 siRNA (Rat)

Sign In for Pricing
View Details
STK40 siRNA (Rat)
CRR5682-02 30 nmol

STK40 siRNA (Rat)

Sign In for Pricing
View Details
S39A8, ID (SLC39A8, BIGM103, ZIP8, Zinc transporter ZIP8, BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, Solute carrier family 39 member 8, Zrt- and Irt-like protein 8) (MaxLight 490) discontinued
041370-ML490 100 µL

S39A8, ID (SLC39A8, BIGM103, ZIP8, Zinc transporter ZIP8, BCG-induced integral membrane protein in monocyte clone 103 protein, LIV-1 subfamily of ZIP zinc transporter 6, Solute carrier family 39 member 8, Zrt- and Irt-like protein 8) (MaxLight 490) discontinued

Sign In for Pricing
View Details
PGRMC2 Polyclonal Antibody
MBS8570891-01 0.1 mL

PGRMC2 Polyclonal Antibody

Sign In for Pricing
View Details
PGRMC2 Polyclonal Antibody
MBS8570891-02 0.1 mL (AF405L)

PGRMC2 Polyclonal Antibody

Sign In for Pricing
View Details
PGRMC2 Polyclonal Antibody
MBS8570891-03 0.1 mL (AF405S)

PGRMC2 Polyclonal Antibody

Sign In for Pricing
View Details