Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP Peptide - middle region

CIRBP Peptide - middle region

Product Specifications

Product Name Alternative

CIRBP, A18HNRNP, CIRP

UniProt

Q14011

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIRBP Rabbit Polyclonal Antibody (orb331432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PA2G4 Recombinant Antibody, APC Conjugated
bsm-62169R-APC-TR 20 µL

PA2G4 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
KRAS (v-Ki-ras2 Kirsten rat Sarcoma Viral Oncogene Homolog, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3, RASK2) (MaxLight 550)
248007-ML550 100 µL

KRAS (v-Ki-ras2 Kirsten rat Sarcoma Viral Oncogene Homolog, C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3, RASK2) (MaxLight 550)

Sign In for Pricing
View Details
Rat HSP70 (Heat Shock Protein 70) ELISA Kit
MBS8806643-01 48 Well

Rat HSP70 (Heat Shock Protein 70) ELISA Kit

Sign In for Pricing
View Details
Rat HSP70 (Heat Shock Protein 70) ELISA Kit
MBS8806643-02 96 Well

Rat HSP70 (Heat Shock Protein 70) ELISA Kit

Sign In for Pricing
View Details
Rat HSP70 (Heat Shock Protein 70) ELISA Kit
MBS8806643-03 5x 96 Well

Rat HSP70 (Heat Shock Protein 70) ELISA Kit

Sign In for Pricing
View Details
Rat HSP70 (Heat Shock Protein 70) ELISA Kit
MBS8806643-04 10x 96 Well

Rat HSP70 (Heat Shock Protein 70) ELISA Kit

Sign In for Pricing
View Details