Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CIRBP Peptide - middle region

CIRBP Peptide - middle region

Product Specifications

Product Name Alternative

CIRBP, A18HNRNP, CIRP

UniProt

Q14011

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CIRBP Rabbit Polyclonal Antibody (orb331432) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001271

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRGRGRGFSRGGGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ocln Rat shRNA Plasmid (Locus ID 83497)
TR711294 1 Kit

Ocln Rat shRNA Plasmid (Locus ID 83497)

Sign In for Pricing
View Details
Klf7 Peptide - middle region
MBS3231551-01 0.1 mg

Klf7 Peptide - middle region

Sign In for Pricing
View Details
Klf7 Peptide - middle region
MBS3231551-02 5x 0.1 mg

Klf7 Peptide - middle region

Sign In for Pricing
View Details
MAP1D, NT (METAP1D, MAP1D, Methionine aminopeptidase 1D, mitochondrial, Methionyl aminopeptidase type 1D, mitochondrial) (MaxLight 405) discontinued
038097-ML405 100 µL

MAP1D, NT (METAP1D, MAP1D, Methionine aminopeptidase 1D, mitochondrial, Methionyl aminopeptidase type 1D, mitochondrial) (MaxLight 405) discontinued

Sign In for Pricing
View Details
IGKV2D-26 3'UTR Lenti-reporter-Luc Vector
24633081 1.0 µg

IGKV2D-26 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
PDSS2 Rabbit Polyclonal Antibody (PE)
orb3003157 100 µg

PDSS2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details