Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COLEC11 Peptide - C-terminal region

COLEC11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

COLEC11, UNQ596/PRO1182

UniProt

Q9BWP8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COLEC11 Rabbit Polyclonal Antibody (orb588087) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEEDCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RHOBTB1 (NM_001032380) Human Over-expression Lysate
LC422316 20 µg

RHOBTB1 (NM_001032380) Human Over-expression Lysate

Sign In for Pricing
View Details
Pirh2 (RCHY1) Rabbit Monoclonal Antibody [Clone ID: R08-1Y-1]
TA422072 100 µL

Pirh2 (RCHY1) Rabbit Monoclonal Antibody [Clone ID: R08-1Y-1]

Sign In for Pricing
View Details
MCM3 Human Gene Knockout Kit (CRISPR)
KN400208 1 Kit

MCM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tmem69 Mouse Gene Knockout Kit (CRISPR)
KN517894 1 Kit

Tmem69 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sonic Hedgehog (SHH) (N-term) Rabbit Polyclonal Antibody
AP23351PU-N 100 µg

Sonic Hedgehog (SHH) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PDXDC1 Antibody
KC-866-01 50 μL

PDXDC1 Antibody

Sign In for Pricing
View Details