BICDL1 Peptide - C-terminal region
BICDL1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
BICDR1, CCDC64, BICDR-1, CCDC64A, H_267D11.1
UniProt
Q6ZP65
Field of Research
Neuroscience
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BICDL1 Rabbit Polyclonal Antibody (orb587190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_997194
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ALNELKRLIQSIVDGMEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC042010-500 1x 500 µL
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]](https://cdn.genprice.uk/products/937/68dd18ba061270361e9083ce/imageurl/cf808732.webp)
CF808732 100 µg
CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
Sign In for Pricing
View Details 