Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BICDL1 Peptide - C-terminal region

BICDL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BICDR1, CCDC64, BICDR-1, CCDC64A, H_267D11.1

UniProt

Q6ZP65

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BICDL1 Rabbit Polyclonal Antibody (orb587190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997194

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALNELKRLIQSIVDGMEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LDL Antibody Pair Set
E-KAB-0156 50 µL & 100 µg

Human LDL Antibody Pair Set

Sign In for Pricing
View Details
H3FA (HIST1H3A) Rabbit Polyclonal Antibody
TA376901 100 µL

H3FA (HIST1H3A) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF405S conjugate, 0.1mg/mL
BNC042010-500 1x 500 µL

NK1.1 / CD161c / Klrb1c, Mouse (PK136), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]
CF808732 100 µg

CIAPIN1 Mouse Monoclonal Antibody [Clone ID: OTI1H4]

Sign In for Pricing
View Details
EXOSC10 Antibody
KC-1114-01 50 μL

EXOSC10 Antibody

Sign In for Pricing
View Details
EXOSC10 Antibody
KC-1114-02 100 µL

EXOSC10 Antibody

Sign In for Pricing
View Details