Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BICDL1 Peptide - C-terminal region

BICDL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BICDR1, CCDC64, BICDR-1, CCDC64A, H_267D11.1

UniProt

Q6ZP65

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BICDL1 Rabbit Polyclonal Antibody (orb587190) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997194

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALNELKRLIQSIVDGMEPTVTLLSVEMTALKEERDRLRVTSEDKEPKEQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-(2-Aminothiazol-4-yl)acetic acid hydrochloride
TRC-A633333-10MG 10 mg

2-(2-Aminothiazol-4-yl)acetic acid hydrochloride

Sign In for Pricing
View Details
CA3 Antibody
8C14939-AAT 50 µg

CA3 Antibody

Sign In for Pricing
View Details
Plasmid DNA MaxiPrep Kit-4p
46500 4 Preparations

Plasmid DNA MaxiPrep Kit-4p

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-01 50 μL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-02 100 µL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-03 1 mL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details