Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFN Peptide - N-terminal region

SFN Peptide - N-terminal region

Product Specifications

Product Name Alternative

SFN, HME1

UniProt

P31947

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFN Rabbit Polyclonal Antibody (orb587904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006133

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Quercetin 7-O-beta-D-Glucuronide
TRC-Q509515-25MG 25 mg

Quercetin 7-O-beta-D-Glucuronide

Sign In for Pricing
View Details
Rpe65 Mouse Gene Knockout Kit (CRISPR)
KN515002 1 Kit

Rpe65 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ADH4 (NM_000670) Human Over-expression Lysate
LY400219 100 µg

ADH4 (NM_000670) Human Over-expression Lysate

Sign In for Pricing
View Details
ROS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]
TA805734BM 100 µL

ROS1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D2]

Sign In for Pricing
View Details
5-Nitro-2-furaldehyde
TRC-N495930-5G 5 g

5-Nitro-2-furaldehyde

Sign In for Pricing
View Details
Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody
AP01203PU-N 100 µg

Frizzled homolog 1 (FZD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details