Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Peptide - N-terminal region

RASGRF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RASGRF1, CDC25, GNRP, GRF1

UniProt

Q13972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRF1 Rabbit Polyclonal Antibody (orb587914) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722522

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793M1-01 25 µg

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]
E-AB-F09793M1-02 100 µg

Elab Fluor® 700 Mouse IgG1, κ Isotype Control[MOPC-21]

Sign In for Pricing
View Details
ASAP1 Human Gene Knockout Kit (CRISPR)
KN417979 1 Kit

ASAP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD3E (NM_000733) Human Recombinant Protein
TP308276L 1 mg

CD3E (NM_000733) Human Recombinant Protein

Sign In for Pricing
View Details
CDK1 Rabbit Polyclonal Antibody
AP08098PU-N 100 µL

CDK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL
BNC403442-500 1x 500 µL

CD81 / TAPA-1 (rC81/3442), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details