Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RASGRF1 Peptide - N-terminal region

RASGRF1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RASGRF1, CDC25, GNRP, GRF1

UniProt

Q13972

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RASGRF1 Rabbit Polyclonal Antibody (orb587914) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_722522

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EVSMREESDIDQNQSDDGDTETSPTKSPTTPKSVKNKNSSEFPLFSYNNG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dylight 350 Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-
DY350-1801-1 1 mg

Dylight 350 Conjugated Phaseolus vulgaris Lectin (Red Kidney Bean) -PHA-L-

Sign In for Pricing
View Details
Human Caveolin 1 (CAV1) ELISA Kit
RD-CAV1-Hu-01 96 Tests

Human Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Human Caveolin 1 (CAV1) ELISA Kit
RD-CAV1-Hu-02 48 Tests

Human Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
CHD4 (3F2/4), CF647 conjugate, 0.1mg/mL
BNC473077-500 1x 500 µL

CHD4 (3F2/4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Myofibroblast Marker (PR 2D3), CF640R conjugate, 0.1mg/mL
BNC403069-100 1x 100 µL

Myofibroblast Marker (PR 2D3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PLA2G1B Human Gene Knockout Kit (CRISPR)
KN416089 1 Kit

PLA2G1B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details