Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NFATC4 Peptide - N-terminal region

NFATC4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NFATC4, NFAT3

UniProt

Q14934

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NFATC4 Rabbit Polyclonal Antibody (orb331409) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005267762

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PSIRITSISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/991 + SOX10/1074), CF405S conjugate, 0.1mg/mL
BNC041074-500 1x 500 µL

SOX10 (SOX10/991 + SOX10/1074), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF568 conjugate, 0.1mg/mL
BNC681035-100 1x 100 µL

CD8 (C8/1035), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10 + C1A/711), CF568 conjugate, 0.1mg/mL
BNC680717-100 1x 100 µL

CD1a (O10 + C1A/711), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL
BNC470177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL
BNC042562-100 1x 100 µL

CD63 (Late Endosomes Marker) (rMX-49.129.5), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details