Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADH5 Peptide - N-terminal region

ADH5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ADH5, ADHX, FDH

UniProt

P11766

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADH5 Rabbit Polyclonal Antibody (orb331412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000662

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LCQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYTVVADISVAK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFRS3 (Serine/Arginine-rich Splicing Factor 3, Pre-mRNA-splicing Factor SRP20, Splicing Factor, Arginine/Serine-rich 3, SRP20) (MaxLight 750) discontinued
133231-ML750 100 µL

SFRS3 (Serine/Arginine-rich Splicing Factor 3, Pre-mRNA-splicing Factor SRP20, Splicing Factor, Arginine/Serine-rich 3, SRP20) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Retinoic Acid Receptor Alpha (RARa) Magnetic Luminex Assay Kit
LKU604130 96 Tests

Retinoic Acid Receptor Alpha (RARa) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
Human PGD protein
orb392275-01 10 µg

Human PGD protein

Sign In for Pricing
View Details
Human PGD protein
orb392275-02 50 µg

Human PGD protein

Sign In for Pricing
View Details
Human PGD protein
orb392275-03 500 µg

Human PGD protein

Sign In for Pricing
View Details
Spectrin alpha chain, erythrocytic 1
AP88445-01 50 µg

Spectrin alpha chain, erythrocytic 1

Sign In for Pricing
View Details