Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM23 Peptide - C-terminal region

ADAM23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADAM23, MDC3

UniProt

O75077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb331427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246989

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3Beta-DOXYL-5alpha-cholestane, Free Radical
TRC-D535525-5MG 5 mg

3Beta-DOXYL-5alpha-cholestane, Free Radical

Sign In for Pricing
View Details
Human PCDH10 activation kit by CRISPRa
GA111602 1 Kit

Human PCDH10 activation kit by CRISPRa

Sign In for Pricing
View Details
Peregrin (BRPF1) Rabbit Polyclonal Antibody
TA374087 100 µL

Peregrin (BRPF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse Brca1 activation kit by CRISPRa
GA200438 1 Kit

Mouse Brca1 activation kit by CRISPRa

Sign In for Pricing
View Details
RP2 (NM_006915) Human Recombinant Protein
TP308124M 100 µg

RP2 (NM_006915) Human Recombinant Protein

Sign In for Pricing
View Details
PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF568 conjugate, 0.1mg/mL
BNC683497-500 1x 500 µL

PAI-RBP1 / SERBP1 / SERPINE1 (SERBP1/3497), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details