Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADAM23 Peptide - C-terminal region

ADAM23 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ADAM23, MDC3

UniProt

O75077

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ADAM23 Rabbit Polyclonal Antibody (orb331427) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005246989

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DCSIRDPVRNLHPPKDEGPKGPSATNLIIGSIAGAILVAAIVLGGTGWGF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sele Mouse Gene Knockout Kit (CRISPR)
KN515483 1 Kit

Sele Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS640252 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Human Lipase, Hepatic (LIPC) ELISA Kit
RD-LIPC-Hu-01 96 Tests

Human Lipase, Hepatic (LIPC) ELISA Kit

Sign In for Pricing
View Details
Human Lipase, Hepatic (LIPC) ELISA Kit
RD-LIPC-Hu-02 48 Tests

Human Lipase, Hepatic (LIPC) ELISA Kit

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL
BNC741739-500 1x 500 µL

P53 Tumor Suppressor Protein (TP53/1739), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SPHK2 (Long Form) Rabbit Polyclonal Antibody
AP05265PU-N 100 µg

SPHK2 (Long Form) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details