Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDB1 Peptide - middle region

DDB1 Peptide - middle region

Product Specifications

Product Name Alternative

DDB1, XAP1

UniProt

Q16531

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDB1 Rabbit Polyclonal Antibody (orb588093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005273861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEV

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCB 1x Element Congener PCB-74 100ug/mL in Isooctane - 1ML
REPCB1029 1 mL

PCB 1x Element Congener PCB-74 100ug/mL in Isooctane - 1ML

Sign In for Pricing
View Details
Rabbit Polyclonal ZAP70 [p Tyr319] Antibody [FITC]
NBP1-18896F 0.1 mL

Rabbit Polyclonal ZAP70 [p Tyr319] Antibody [FITC]

Sign In for Pricing
View Details
2-heptyl-3,4-Quinoline-5,6,7,8-d4-diol
TRC-H283120-100MG 100 mg

2-heptyl-3,4-Quinoline-5,6,7,8-d4-diol

Sign In for Pricing
View Details
Zc3h12d Mouse Gene Knockout Kit (CRISPR)
KN519639 1 Kit

Zc3h12d Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Biotin anti-human CD3
E16FHB003-025 25 Tests

Biotin anti-human CD3

Sign In for Pricing
View Details
Egr-2 (G-9) Alexa Fluor® 680
sc-518117 AF680 200 µg/mL

Egr-2 (G-9) Alexa Fluor® 680

Sign In for Pricing
View Details