Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDB1 Peptide - middle region

DDB1 Peptide - middle region

Product Specifications

Product Name Alternative

DDB1, XAP1

UniProt

Q16531

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDB1 Rabbit Polyclonal Antibody (orb588093) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005273861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IGIHEHASIDLPGIKGLWPLRSDPNRETDDTLVLSFVGQTRVLMLNGEEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Peroxiredoxin 6 (PRDX6)
SIPF881Bo01-01 10 µg

Recombinant Peroxiredoxin 6 (PRDX6)

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 6 (PRDX6)
SIPF881Bo01-02 50 µg

Recombinant Peroxiredoxin 6 (PRDX6)

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 6 (PRDX6)
SIPF881Bo01-03 200 µg

Recombinant Peroxiredoxin 6 (PRDX6)

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 6 (PRDX6)
SIPF881Bo01-04 1 mg

Recombinant Peroxiredoxin 6 (PRDX6)

Sign In for Pricing
View Details
Recombinant Peroxiredoxin 6 (PRDX6)
SIPF881Bo01-05 5 mg

Recombinant Peroxiredoxin 6 (PRDX6)

Sign In for Pricing
View Details
KCNJ3 Polyclonal Antibody
orb618636-01 50 μL

KCNJ3 Polyclonal Antibody

Sign In for Pricing
View Details