Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFB Peptide - C-terminal region

DFFB Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFFB, CAD, DFF2, DFF40

UniProt

O76075

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DFFB Rabbit Polyclonal Antibody (orb588096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004393

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNNT3 (NM_006757) Human Tagged ORF Clone Lentiviral Particle
RC216642L3V 200 µL

TNNT3 (NM_006757) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
FMO3 Rabbit Polyclonal Antibody (APC-Cy7)
orb2527080 100 µL

FMO3 Rabbit Polyclonal Antibody (APC-Cy7)

Sign In for Pricing
View Details
Class E Basic helix-loop-helix protein 41 (BHLHE41) Human ELISA Kit
C3930 96 Tests

Class E Basic helix-loop-helix protein 41 (BHLHE41) Human ELISA Kit

Sign In for Pricing
View Details
BTZO-1 10mg
A22406-10 10 mg

BTZO-1 10mg

Sign In for Pricing
View Details
Rat Hepatitis E Virus Antigen (HEV-Ag) ELISA Kit
SL1898Ra-01 48 Tests

Rat Hepatitis E Virus Antigen (HEV-Ag) ELISA Kit

Sign In for Pricing
View Details
Rat Hepatitis E Virus Antigen (HEV-Ag) ELISA Kit
SL1898Ra-02 96 Tests

Rat Hepatitis E Virus Antigen (HEV-Ag) ELISA Kit

Sign In for Pricing
View Details