Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DFFB Peptide - C-terminal region

DFFB Peptide - C-terminal region

Product Specifications

Product Name Alternative

DFFB, CAD, DFF2, DFF40

UniProt

O76075

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DFFB Rabbit Polyclonal Antibody (orb588096) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004393

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Monkey Alanine ELISA Kit
MBS7278043-01 48 Well

Monkey Alanine ELISA Kit

Sign In for Pricing
View Details
Monkey Alanine ELISA Kit
MBS7278043-02 96 Well

Monkey Alanine ELISA Kit

Sign In for Pricing
View Details
Monkey Alanine ELISA Kit
MBS7278043-03 5x 96 Well

Monkey Alanine ELISA Kit

Sign In for Pricing
View Details
Monkey Alanine ELISA Kit
MBS7278043-04 10x 96 Well

Monkey Alanine ELISA Kit

Sign In for Pricing
View Details
ARAP1 Protein Vector (Mouse) (pPB-C-His)
PV155522 500 ng

ARAP1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ASAP2 Protein Vector (Mouse) (pPM-C-HA)
PV156568 500 ng

ASAP2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details