Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DIXDC1 Peptide - middle region

DIXDC1 Peptide - middle region

Product Specifications

Product Name Alternative

DIXDC1, CCD1, KIAA1735

UniProt

Q155Q3

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DIXDC1 Rabbit Polyclonal Antibody (orb331434) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_219493

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LEHKDVLLAHCMKREADEATNYNSHNSQSNGFLLPTAGKGATSVSNRGTS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 4L (ND4L)
MBS1073621 Inquire

Recombinant Debaryomyces hansenii NADH-ubiquinone oxidoreductase chain 4L (ND4L)

Sign In for Pricing
View Details
Antiparasitic agent-27
HY-175364 1 Each

Antiparasitic agent-27

Sign In for Pricing
View Details
Caspase-7 (CASP7) (NM_001227) Human Tagged ORF Clone
RC221545 10 µg

Caspase-7 (CASP7) (NM_001227) Human Tagged ORF Clone

Sign In for Pricing
View Details
Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody
abx403574-01 100 µL

Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody

Sign In for Pricing
View Details
Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody
abx403574-02 200 µL

Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody

Sign In for Pricing
View Details
Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody
abx403574-03 1 mL

Killer Cell Immunoglobulin Like Receptor 2DS4 (KIR2DS4) Antibody

Sign In for Pricing
View Details