Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DOK3 Peptide - C-terminal region

DOK3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DOK3

UniProt

Q7L591

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DOK3 Rabbit Polyclonal Antibody (orb331436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VLEASPTLHGGEPEPHEGPGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7204157-01 48 Well

Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7204157-02 96 Well

Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7204157-03 5x 96 Well

Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit
MBS7204157-04 10x 96 Well

Canine Arrestin domain-containing protein 4 (ARRDC4) ELISA Kit

Sign In for Pricing
View Details
TMP-CP
BLG-T008-05 5 μmoL

TMP-CP

Sign In for Pricing
View Details
TLC Plates, Silica gel 60, Glass Backing, H, 2.5x5cm, pack of 640
SI56023 1 Each

TLC Plates, Silica gel 60, Glass Backing, H, 2.5x5cm, pack of 640

Sign In for Pricing
View Details