DOK3 Peptide - C-terminal region
DOK3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
DOK3
UniProt
Q7L591
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DOK3 Rabbit Polyclonal Antibody (orb331436) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VLEASPTLHGGEPEPHEGPGSRSPTTSPIYHNGQDLSWPGPANDSTLEAQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC212769A1V 250 µL
Human D aspartate oxidase (DDO) (NM_004032) AAV Particle
Sign In for Pricing
View Details 
RC219943L1V 200 µL
GDNF Receptor alpha 1 (GFRA1) (NM_005264) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details 040932-ML490 100 µL
RDH10, ID (RDH10, Retinol dehydrogenase 10) (MaxLight 490) discontinued
Sign In for Pricing
View Details 
K1547303 1.0 µg DNA
OR9A3P sgRNA CRISPR Lentivector (Human) (Target 2)
Sign In for Pricing
View Details 
131956-HRP 100 µL
PSMB5 (LMPX, MB1, X, Proteasome Subunit beta type-5, Macropain epsilon Chain, Multicatalytic Endopeptidase Complex epsilon Chain, Proteasome Chain 6, Proteasome epsilon Chain, Proteasome Subunit MB1, Proteasome Subunit X, MGC104214) (HRP)
Sign In for Pricing
View Details