Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP2 Peptide - C-terminal region

BNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BNIP2, NIP2

UniProt

Q12982

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP2 Rabbit Polyclonal Antibody (orb585145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPX Protein, Human, Recombinant (C-His)
E51P00468 100 µg

HPX Protein, Human, Recombinant (C-His)

Sign In for Pricing
View Details
CENPC1 293 Cell Lysate
409238 0.1 mg

CENPC1 293 Cell Lysate

Sign In for Pricing
View Details
LXR alpha Rabbit mAb
MBS9470346-01 0.05 mL

LXR alpha Rabbit mAb

Sign In for Pricing
View Details
LXR alpha Rabbit mAb
MBS9470346-02 0.1 mL

LXR alpha Rabbit mAb

Sign In for Pricing
View Details
LXR alpha Rabbit mAb
MBS9470346-03 5x 0.1 mL

LXR alpha Rabbit mAb

Sign In for Pricing
View Details
Rat copine III (CPNE3) ELISA Kit
201-11-0897 96 Tests

Rat copine III (CPNE3) ELISA Kit

Sign In for Pricing
View Details