Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BNIP2 Peptide - C-terminal region

BNIP2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BNIP2, NIP2

UniProt

Q12982

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BNIP2 Rabbit Polyclonal Antibody (orb585145) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SSKFSQKIRYVFNLAELAELVPMEYVGIPECIKQVDQELNGKQDEPKNEQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Echistatin
FE110368 1 mg

Echistatin

Sign In for Pricing
View Details
HBM Polyclonal Antibody
JOT-AP09827-01 20 µL

HBM Polyclonal Antibody

Sign In for Pricing
View Details
HBM Polyclonal Antibody
JOT-AP09827-02 50 μL

HBM Polyclonal Antibody

Sign In for Pricing
View Details
HBM Polyclonal Antibody
JOT-AP09827-03 100 µL

HBM Polyclonal Antibody

Sign In for Pricing
View Details
ZBED1 Antibody, Biotin conjugated
A39226-50UG 50 µg

ZBED1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Polyclonal Antibody to Ribosomal Protein L27 (RPL27)
TRV-0059180-01 20 µL

Polyclonal Antibody to Ribosomal Protein L27 (RPL27)

Sign In for Pricing
View Details