Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPS6 Peptide - N-terminal region

HPS6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HPS6

UniProt

Q86YV9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPS6 Rabbit Polyclonal Antibody (orb331315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079023

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GARVVAVAALRGRLVWCEERQARAEGPSGSPAAAFSHCVCVRTLEPSGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACBD3 Rabbit Monoclonal Antibody [Clone ID: 23GB3620]
TA424469 100 µL

ACBD3 Rabbit Monoclonal Antibody [Clone ID: 23GB3620]

Sign In for Pricing
View Details
Pospiviroid TaqMan RT-PCR Kit
TM53750 100 Reactions

Pospiviroid TaqMan RT-PCR Kit

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS705903 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
CD6 (C6/372), CF640R conjugate, 0.1mg/mL
BNC400372-100 1x 100 µL

CD6 (C6/372), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
XRCC3 (10F1/6), CF640R conjugate, 0.1mg/mL
BNC402842-100 1x 100 µL

XRCC3 (10F1/6), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PRAMEF14 (NM_001099854) Human Over-expression Lysate
LC420543 20 µg

PRAMEF14 (NM_001099854) Human Over-expression Lysate

Sign In for Pricing
View Details