Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HPS6 Peptide - N-terminal region

HPS6 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HPS6

UniProt

Q86YV9

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HPS6 Rabbit Polyclonal Antibody (orb331315) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079023

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GARVVAVAALRGRLVWCEERQARAEGPSGSPAAAFSHCVCVRTLEPSGEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Acetyl-d3-L-4-hydroxyphenylalanine
TRC-A189737-5MG 5 mg

N-Acetyl-d3-L-4-hydroxyphenylalanine

Sign In for Pricing
View Details
Primer Panel
HPP6013D 200x 96 reactions in matrix tubes

Primer Panel

Sign In for Pricing
View Details
CST3 Antibody
KC-6024-01 50 μL

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
KC-6024-02 100 µL

CST3 Antibody

Sign In for Pricing
View Details
CST3 Antibody
KC-6024-03 1 mL

CST3 Antibody

Sign In for Pricing
View Details
Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]
TA805152BM 100 µL

Nkx3.1 (NKX3-1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A5]

Sign In for Pricing
View Details