Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUPL2 Peptide - N-terminal region

NUPL2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

NUPL2, CG1

UniProt

O15504

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NUPL2 Rabbit Polyclonal Antibody (orb586559) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MAICQFFLQGRCRFGDRCWNEHPGARGAGGGRQQPQQQPSGNNRRGWNTT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC8 AAV Vector (Human) (CMV)
43775101 1 µg

SIGLEC8 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Olr259 sgRNA CRISPR Lentivector set (Rat)
K7286101 3x 1.0 µg

Olr259 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
VMAC Rabbit Polyclonal Antibody
orb3072095-01 30 µL

VMAC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VMAC Rabbit Polyclonal Antibody
orb3072095-02 50 µL

VMAC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VMAC Rabbit Polyclonal Antibody
orb3072095-03 100 µL

VMAC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
VMAC Rabbit Polyclonal Antibody
orb3072095-04 200 µL

VMAC Rabbit Polyclonal Antibody

Sign In for Pricing
View Details