Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS8L3 Peptide - middle region

EPS8L3 Peptide - middle region

Product Specifications

Product Name Alternative

EPS8L3, EPS8R3

UniProt

Q8TE67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS8L3 Rabbit Polyclonal Antibody (orb586675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK) ELISA Kit
RDR-MUSK-Hu-01 96 Tests

Human Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK) ELISA Kit

Sign In for Pricing
View Details
Human Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK) ELISA Kit
RDR-MUSK-Hu-02 48 Tests

Human Muscle, Skeletal, Receptor Tyrosine Kinase (MUSK) ELISA Kit

Sign In for Pricing
View Details
RPEL1 Human Gene Knockout Kit (CRISPR)
KN427890 1 Kit

RPEL1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Texas Red Conjugated Goat Affinity Purified Antibody to Human IgM
TAF-003-2 2 mL

Texas Red Conjugated Goat Affinity Purified Antibody to Human IgM

Sign In for Pricing
View Details
CD90 / THY1 Recombinant Rabbit monoclonal Antibody [SU35-07]
ET1608-46-50UL 50 µL

CD90 / THY1 Recombinant Rabbit monoclonal Antibody [SU35-07]

Sign In for Pricing
View Details
Dry Bath Incubator with Touchscreen for two separate blocks
EL-01DT 1 Unit

Dry Bath Incubator with Touchscreen for two separate blocks

Sign In for Pricing
View Details