Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EPS8L3 Peptide - middle region

EPS8L3 Peptide - middle region

Product Specifications

Product Name Alternative

EPS8L3, EPS8R3

UniProt

Q8TE67

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EPS8L3 Rabbit Polyclonal Antibody (orb586675) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LFMGKLEKAQAKTSRKKKFGKKNKDQGGLTQAQYIDCFQKIKHSFNLLGR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ADAMTS4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F1]
TA805173AM 100 µL

ADAMTS4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6F1]

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS708105 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
C13orf8 (CHAMP1) Rabbit Polyclonal Antibody
TA374703 100 µL

C13orf8 (CHAMP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Serum Amyloid A Antibody
RC-15574-01 50 μL

Recombinant Serum Amyloid A Antibody

Sign In for Pricing
View Details
Recombinant Serum Amyloid A Antibody
RC-15574-02 100 µL

Recombinant Serum Amyloid A Antibody

Sign In for Pricing
View Details
Recombinant Serum Amyloid A Antibody
RC-15574-03 1 mL

Recombinant Serum Amyloid A Antibody

Sign In for Pricing
View Details