Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYB561D2 Peptide - N-terminal region

CYB561D2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CYB561D2,101F6, LUCA12.2

UniProt

O14569

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CYB561D2 Rabbit Polyclonal Antibody (orb331370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264889

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FSPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF418 Human Gene Knockout Kit (CRISPR)
KN415975 1 Kit

ZNF418 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF640R conjugate, 0.1mg/mL
BNC400049-500 1x 500 µL

CD31 / PECAM-1 (C31.3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant ERK3 Antibody
RC-5089-01 50 μL

Recombinant ERK3 Antibody

Sign In for Pricing
View Details
Recombinant ERK3 Antibody
RC-5089-02 100 µL

Recombinant ERK3 Antibody

Sign In for Pricing
View Details
Recombinant ERK3 Antibody
RC-5089-03 1 mL

Recombinant ERK3 Antibody

Sign In for Pricing
View Details
Activin Receptor Type IA (ACVR1) Rabbit Polyclonal Antibody
TA366883 100 µL

Activin Receptor Type IA (ACVR1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details