CYB561D2 Peptide - N-terminal region
CYB561D2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
CYB561D2,101F6, LUCA12.2
UniProt
O14569
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CYB561D2 Rabbit Polyclonal Antibody (orb331370) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_005264889
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FSPESSLLHSLSRKGRARCHWVLQLLALLCALLGLGLVILHKEQLGKAHL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB1492-500 1x 500 µL
PAX8 (Renal Cell Marker) (PAX8/1492), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472885-500 1x 500 µL
CD81 / TAPA-1 (C81/2885R), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details