Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - C-terminal region

MTMR7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTMR7

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR7 Rabbit Polyclonal Antibody (orb586857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004677

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELEALEERLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Prostate
CS507128 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
FUT2 (NM_000511) Human Over-expression Lysate
LY424669 100 µg

FUT2 (NM_000511) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXO3 (NM_201559) Human Over-expression Lysate
LC404461 20 µg

FOXO3 (NM_201559) Human Over-expression Lysate

Sign In for Pricing
View Details
MTRNR2L8 Human Gene Knockout Kit (CRISPR)
KN430908 1 Kit

MTRNR2L8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,6-Dibromo-9H-fluoren-9-one
TRC-D424682-250MG 250 mg

3,6-Dibromo-9H-fluoren-9-one

Sign In for Pricing
View Details
Crude Euonymus europaeus Lectin (Spindle Tree) -EEA-
L-4200-20 20 mg

Crude Euonymus europaeus Lectin (Spindle Tree) -EEA-

Sign In for Pricing
View Details