Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTMR7 Peptide - C-terminal region

MTMR7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTMR7

UniProt

Q9Y216

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTMR7 Rabbit Polyclonal Antibody (orb586857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004677

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EELEALEERLEKIQKVQLNCTKVKSKQSEPSKHSGFSTSDNSIANTPQDY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10?l tip box with ultra low retention tip BPIC-718
BPIC-718 1 Unit

10?l tip box with ultra low retention tip BPIC-718

Sign In for Pricing
View Details
PAK1 Rabbit Polyclonal Antibody
AP20990PU-N 100 µg

PAK1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
UEVLD Human qPCR Primer Pair (NM_018314)
HP225675 200 Reactions

UEVLD Human qPCR Primer Pair (NM_018314)

Sign In for Pricing
View Details
NOTCH4 Human Gene Knockout Kit (CRISPR)
KN221762BN 1 Kit

NOTCH4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Engrailed 1 Recombinant Rabbit monoclonal Antibody
HA751208 100 µL

Engrailed 1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS708400 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details