Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SH3YL1 Peptide - C-terminal region

SH3YL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SH3YL1

UniProt

Q96HL8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SH3YL1 Rabbit Polyclonal Antibody (orb586896) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056492

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PPKPLSRPQQSSAPVQLNSGSQSNRNEYKLYPGLSSYHERVGNLNQPIEV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRP Conjugated HIV1 p24 Mouse Monoclonal Antibody [12G2]
HA601160 100 µL

HRP Conjugated HIV1 p24 Mouse Monoclonal Antibody [12G2]

Sign In for Pricing
View Details
Human HSP90AB1 activation kit by CRISPRa
GA102269 1 Kit

Human HSP90AB1 activation kit by CRISPRa

Sign In for Pricing
View Details
Human TPO/Thrombopoietin, C-His Tag
HA211023-01 Inquire

Human TPO/Thrombopoietin, C-His Tag

Sign In for Pricing
View Details
Human TPO/Thrombopoietin, C-His Tag
HA211023-02 50 µg

Human TPO/Thrombopoietin, C-His Tag

Sign In for Pricing
View Details
Human TPO/Thrombopoietin, C-His Tag
HA211023-03 100 µg

Human TPO/Thrombopoietin, C-His Tag

Sign In for Pricing
View Details
C1orf54 (NM_001301041) Human Tagged ORF Clone
RG235634 10 µg

C1orf54 (NM_001301041) Human Tagged ORF Clone

Sign In for Pricing
View Details