Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOLA3 Peptide - N-terminal region

BOLA3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BOLA3

UniProt

Q53S33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOLA3 Rabbit Polyclonal Antibody (orb326706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997717

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KIF4A (NM_012310) Human Tagged ORF Clone
RC213971 10 µg

KIF4A (NM_012310) Human Tagged ORF Clone

Sign In for Pricing
View Details
ASH2L Antibody [G9J14]
C15855-20uL 20 µL

ASH2L Antibody [G9J14]

Sign In for Pricing
View Details
Bovine Interleukin 1 Beta (IL1b) ELISA Kit
MBS456392-01 48 Tests

Bovine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 1 Beta (IL1b) ELISA Kit
MBS456392-02 96 Tests

Bovine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 1 Beta (IL1b) ELISA Kit
MBS456392-03 5x 96 Tests

Bovine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details
Bovine Interleukin 1 Beta (IL1b) ELISA Kit
MBS456392-04 10x 96 Tests

Bovine Interleukin 1 Beta (IL1b) ELISA Kit

Sign In for Pricing
View Details