Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOLA3 Peptide - N-terminal region

BOLA3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BOLA3

UniProt

Q53S33

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with BOLA3 Rabbit Polyclonal Antibody (orb326706) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_997717

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human RSPH3 activation kit by CRISPRa
GA113281 1 Kit

Human RSPH3 activation kit by CRISPRa

Sign In for Pricing
View Details
Testin Protein Vector (Rat) (pPB-C-His)
PV310414 500 ng

Testin Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
3- (1- (tert-Butoxycarbonyl) piperidin-4-yl) prop-2-ynoic acid
YXC26347-01 50 mg

3- (1- (tert-Butoxycarbonyl) piperidin-4-yl) prop-2-ynoic acid

Sign In for Pricing
View Details
3- (1- (tert-Butoxycarbonyl) piperidin-4-yl) prop-2-ynoic acid
YXC26347-02 0.5 g

3- (1- (tert-Butoxycarbonyl) piperidin-4-yl) prop-2-ynoic acid

Sign In for Pricing
View Details
Cytokine Receptor-Like Factor 1 (CRLF1) Monkey ELISA Kit
C6202 96 Tests

Cytokine Receptor-Like Factor 1 (CRLF1) Monkey ELISA Kit

Sign In for Pricing
View Details
SPPL2A Rabbit pAb (APR22106N)
APR22106N-01 50 µL

SPPL2A Rabbit pAb (APR22106N)

Sign In for Pricing
View Details